Tested Applications
| Positive WB detected in | human heart tissue, rat heart tissue, MCF-7 cells, HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:2000-1:6000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below | 
Product Information
67043-1-Ig targets COMMD5 in WB, ELISA applications and shows reactivity with Human, Rat samples.
| Tested Reactivity | Human, Rat | 
| Cited Reactivity | human | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag18464 Product name: Recombinant human COMMD5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 4-159 aa of BC003055 Sequence: VGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRV Predict reactive species | 
                                    
| Full Name | COMM domain containing 5 | 
| Calculated Molecular Weight | 25 kDa | 
| Observed Molecular Weight | 15 kDa | 
| GenBank Accession Number | BC003055 | 
| Gene Symbol | COMMD5 | 
| Gene ID (NCBI) | 28991 | 
| RRID | AB_2882357 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q9GZQ3 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
COMM domain containing 5 (COMMD5, synonyms: HCARG, HT002) is a hypertension-related calcium-regulated gene. COMMD5 is negatively regulated by extracellular calcium concentration, and its basal mRNA levels were higher in hypertensive animals. Tissue distribution of COMMD5 shows a preponderance in the heart, stomach, jejunum, kidney (tubular fraction), liver, and adrenal gland (mainly in the medulla). COMMD5 mRNA is significantly more expressed in adult than in fetal organs, and its levels are decreased in tumors and cancerous cell lines. COMMD5 protein has no transmembrane domain, but contains 67% -helix content, a calcium-binding site, four putative "leucine zipper" motifs, and a nuclear receptor-binding domain. At the subcellular level, COMMD5 shows a nuclear localization.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for COMMD5 antibody 67043-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Aging (Albany NY) TMT-based quantitative proteomic analysis revealed that FBLN2 and NPR3 are involved in the early osteogenic differentiation of mesenchymal stem cells (MSCs) | ||
BMC Med Genomics CCDC22 mutations that impair COMMD binding cause attenuated 3C/Ritscher-Schinzel syndrome | 







