Product Information
67043-1-PBS targets COMMD5 in WB, Indirect ELISA applications and shows reactivity with Human, Rat samples.
| Tested Reactivity | Human, Rat | 
| Host / Isotype | Mouse / IgG2a | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag18464 Product name: Recombinant human COMMD5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 4-159 aa of BC003055 Sequence: VGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRV Predict reactive species | 
                                    
| Full Name | COMM domain containing 5 | 
| Calculated Molecular Weight | 25 kDa | 
| Observed Molecular Weight | 15 kDa | 
| GenBank Accession Number | BC003055 | 
| Gene Symbol | COMMD5 | 
| Gene ID (NCBI) | 28991 | 
| RRID | AB_2882357 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein A purification | 
| UNIPROT ID | Q9GZQ3 | 
| Storage Buffer | PBS only, pH 7.3. | 
| Storage Conditions | Store at -80°C. | 
Background Information
COMM domain containing 5 (COMMD5, synonyms: HCARG, HT002) is a hypertension-related calcium-regulated gene. COMMD5 is negatively regulated by extracellular calcium concentration, and its basal mRNA levels were higher in hypertensive animals. Tissue distribution of COMMD5 shows a preponderance in the heart, stomach, jejunum, kidney (tubular fraction), liver, and adrenal gland (mainly in the medulla). COMMD5 mRNA is significantly more expressed in adult than in fetal organs, and its levels are decreased in tumors and cancerous cell lines. COMMD5 protein has no transmembrane domain, but contains 67% -helix content, a calcium-binding site, four putative "leucine zipper" motifs, and a nuclear receptor-binding domain. At the subcellular level, COMMD5 shows a nuclear localization.







