COMMD5 Monoclonal antibody, PBS Only

COMMD5 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67043-1-PBS
Clone No.1E10G6

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Rat

Applications

WB, Indirect ELISA

COMM domain containing 5, COMMD5, FLJ13008, HCARG, HT002

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67043-1-PBS targets COMMD5 in WB, Indirect ELISA applications and shows reactivity with Human, Rat samples.

Tested Reactivity Human, Rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18464

Product name: Recombinant human COMMD5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 4-159 aa of BC003055

Sequence: VGAATPYLHHPGDSHSGRVSFLGAQLPPEVAAMARLLGDLDRSTFRKLLKFVVSSLQGEDCREAVQRLGVSANLPEEQLGALLAGMHTLLQQALRLPPTSLKPDTFRDQLQELCIPQDLVGDLASVVFGSQRPLLDSVAQQQGAWLPHVADFRWRV

Predict reactive species
Full Name COMM domain containing 5
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 15 kDa
GenBank Accession NumberBC003055
Gene Symbol COMMD5
Gene ID (NCBI) 28991
RRIDAB_2882357
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9GZQ3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COMM domain containing 5 (COMMD5, synonyms: HCARG, HT002) is a hypertension-related calcium-regulated gene. COMMD5 is negatively regulated by extracellular calcium concentration, and its basal mRNA levels were higher in hypertensive animals. Tissue distribution of COMMD5 shows a preponderance in the heart, stomach, jejunum, kidney (tubular fraction), liver, and adrenal gland (mainly in the medulla). COMMD5 mRNA is significantly more expressed in adult than in fetal organs, and its levels are decreased in tumors and cancerous cell lines. COMMD5 protein has no transmembrane domain, but contains 67% -helix content, a calcium-binding site, four putative "leucine zipper" motifs, and a nuclear receptor-binding domain. At the subcellular level, COMMD5 shows a nuclear localization.

Loading...
||
New chat Able
正在加载,请稍候...