Tested Applications
| Positive WB detected in | HeLa cells, T-47D cells, HCT 116 cells, A431 cells, MOLT-4 cells, TF-1 cells, HSC-T6 cells, ROS1728 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67256-1-Ig targets CDK9 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29178 Product name: Recombinant human CDK9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-372 aa of BC001968 Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF Predict reactive species |
| Full Name | cyclin-dependent kinase 9 |
| Calculated Molecular Weight | 372 aa, 43 kDa |
| Observed Molecular Weight | 38-42 kDa, 55 kDa |
| GenBank Accession Number | BC001968 |
| Gene Symbol | CDK9 |
| Gene ID (NCBI) | 1025 |
| RRID | AB_3085038 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P50750 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CDK9 antibody 67256-1-Ig | Download protocol |
| WB protocol for CDK9 antibody 67256-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



