CDK9 Monoclonal antibody, PBS Only

• 

  WB analysis using 67256-1-Ig (same clone as 67256-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67256-1-Ig (CDK9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67256-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67256-1-Ig (same clone as 67256-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK9 antibody (67256-1-Ig, Clone: 1G6B3 ) at dilution of 1:1000 and Multi-rAbCoraLite Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM004, 1:500) were used for detection. This data was developed using the same antibody clone with 67256-1-PBS in a different storage buffer formulation.

CDK9 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 67256-1-PBS

Clone No.1G6B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

1G6B3, C 2k, C-2K, CDC2L4, Cell division cycle 2-like protein kinase 4

---

Product Information

67256-1-PBS targets CDK9 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29178

  Product name: Recombinant human CDK9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-372 aa of BC001968

  Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

• Full Name: cyclin-dependent kinase 9
• Calculated Molecular Weight: 372 aa, 43 kDa
• Observed Molecular Weight: 38-42 kDa, 55 kDa
• GenBank Accession Number: BC001968
• Gene Symbol: CDK9
• Gene ID (NCBI): 1025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P50750
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).