CDK9 Monoclonal antibody, PBS Only

CDK9 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 67256-1-PBS
Clone No.1G6B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

1G6B3, C 2k, C-2K, CDC2L4, Cell division cycle 2-like protein kinase 4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67256-1-PBS targets CDK9 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29178

Product name: Recombinant human CDK9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-372 aa of BC001968

Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Predict reactive species
Full Name cyclin-dependent kinase 9
Calculated Molecular Weight 372 aa, 43 kDa
Observed Molecular Weight38-42 kDa, 55 kDa
GenBank Accession NumberBC001968
Gene Symbol CDK9
Gene ID (NCBI) 1025
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50750
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).

Loading...
||
New chat

Able

正在加载,请稍候...