Product Information
67289-4-PBS targets ERN2 as part of a matched antibody pair:
MP50782-2: 67289-2-PBS capture and 67289-4-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29452 Product name: Recombinant human ERN2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 452-563 aa of BC157113 Sequence: SLSREKLWDSELHPEEKTPDSYLGLGPQDLLAASLTAVLLGGWILFVMRQQQPQVVEKQQETPLAPADFAHISQDAQSLHSGASRRSQKRLQSPSKQAQPLDDPEAEQLTVV Predict reactive species |
| Full Name | endoplasmic reticulum to nucleus signaling 2 |
| GenBank Accession Number | BC157113 |
| Gene Symbol | ERN2 |
| Gene ID (NCBI) | 10595 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | Q76MJ5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

