Product Information
67338-2-PBS targets PSMD9 as part of a matched antibody pair:
MP51695-1: 67338-2-PBS capture and 67338-3-PBS detection (validated in Cytometric bead array)
MP51695-2: 67338-2-PBS capture and 67338-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25654 Product name: Recombinant human PSMD9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-102 aa of BC004213 Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA Predict reactive species |
| Full Name | proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 |
| Calculated Molecular Weight | 27 kDa |
| GenBank Accession Number | BC004213 |
| Gene Symbol | PSMD9 |
| Gene ID (NCBI) | 5715 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O00233 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |







