Tested Applications
| Positive WB detected in | human adipose tissue, human placenta tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67573-1-Ig targets Serpin A12/Vaspin in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30136 Product name: Recombinant human SERPINA12 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 275-370 aa of BC040857 Sequence: PDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAG Predict reactive species |
| Full Name | serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 |
| Calculated Molecular Weight | 414 aa, 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC040857 |
| Gene Symbol | Vaspin |
| Gene ID (NCBI) | 145264 |
| RRID | AB_2882786 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q8IW75 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Serpin A12/Vaspin antibody 67573-1-Ig | Download protocol |
| WB protocol for Serpin A12/Vaspin antibody 67573-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





