Serpin A12/Vaspin Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 67573-1-Ig (same clone as 67573-1-PBS)

  Human adipose tissue were subjected to SDS PAGE followed by western blot with 67573-1-Ig (Vaspin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67573-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67573-1-Ig (same clone as 67573-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67573-1-Ig (Vaspin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67573-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67573-1-Ig (same clone as 67573-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Vaspin antibody (67573-1-Ig, Clone: 2A1B6 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67573-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51421-1

  Cytometric bead array sample test of MP51421-1, SERPINA12 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67573-1-PBS. Detection antibody: 67573-2-PBS.

• 

  Cytometric bead array standard curve of MP51421-1

  Cytometric bead array standard curve of MP51421-1, SERPINA12 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67573-1-PBS. Detection antibody: 67573-2-PBS. Standard:Ag30136. Range: 0.098-100 ng/mL.

Serpin A12/Vaspin Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67573-1-PBS

Clone No.2A1B6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

SERPINA12, SERPINA12/Vaspin, Vaspin, 2A1B6, OL 64

---

Product Information

67573-1-PBS targets Serpin A12/Vaspin as part of a matched antibody pair:

MP51421-1: 67573-1-PBS capture and 67573-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30136

  Product name: Recombinant human SERPINA12 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 275-370 aa of BC040857

  Sequence: PDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAG

• Full Name: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12
• Calculated Molecular Weight: 414 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC040857
• Gene Symbol: Vaspin
• Gene ID (NCBI): 145264
• RRID: AB_2882786
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IW75
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327).