Serpin A12/Vaspin Monoclonal antibody, PBS Only (Capture)

Serpin A12/Vaspin Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 67573-1-PBS
Clone No.2A1B6

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

SERPINA12, SERPINA12/Vaspin, Vaspin, 2A1B6, OL 64

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67573-1-PBS targets Serpin A12/Vaspin as part of a matched antibody pair:

MP51421-1: 67573-1-PBS capture and 67573-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30136

Product name: Recombinant human SERPINA12 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 275-370 aa of BC040857

Sequence: PDEGKLKHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVGEAVHKAELKMDERGTEGAAG

Predict reactive species
Full Name serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12
Calculated Molecular Weight 414 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC040857
Gene Symbol Vaspin
Gene ID (NCBI) 145264
RRIDAB_2882786
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IW75
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SERPINA12 is also named as Serpin A12 and Visceral adipose tissue-derived serine protease inhibitor (Vaspin). Vaspin is an adipokine belonging to the serpin family, thus also named SERPINA12, with targets in kallikrein 7 and 14 that participates in skin desquamation (PMID: 34359881). Vaspin is a compensatory molecule in obesity and insulin resistance (PMID: 18321232). Vaspin is a newly described adipokine with an insulin sensitizing effect and inhibitory impact on food intake (PMID: 16030142, PMID: 21465327).

Loading...
||
New chat Able
正在加载,请稍候...