Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

FABP2 Monoclonal antibody

FABP2 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67691-1-Ig
Clone No.2D11G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, ELISA

2D11G6, FABPI, Fatty acid binding protein 2, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat small intestine tissue, human jejunum tissue, COLO 320 cells, pig duodenum, mouse small intestine, rabbit small intestine
Positive IHC detected inmouse small intestine tissue, mouse colon tissue, rat small intestine tissue, human small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse colon tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:50000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67691-1-Ig targets FABP2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivitymouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17620

Product name: Recombinant human FABP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-132 aa of BC069617

Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Predict reactive species
Full Name fatty acid binding protein 2, intestinal
Calculated Molecular Weight 132 aa, 15 kDa
Observed Molecular Weight15 kDa
GenBank Accession NumberBC069617
Gene Symbol FABP2
Gene ID (NCBI) 2169
RRIDAB_2882884
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP12104
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FABP2, also known as the intestinal fatty acid binding protein (I-FABP), is expressed in the absorptive intestinal villus cells. It is mainly involved in intracellular transport and intestinal absorption of lipids. FABP2 has been considered a marker of mucosal injury and ischemia and serum I-FABP level is used as a tissue damage indicator. In addition, it is a marker of differentiated intestinal epithelial cells.

Protocols

Product Specific Protocols
IF protocol for FABP2 antibody 67691-1-IgDownload protocol
IHC protocol for FABP2 antibody 67691-1-IgDownload protocol
WB protocol for FABP2 antibody 67691-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIF

Gut Microbes

Infant feces-derived Lactobacillus gasseri FWJL-4 mitigates experimental necrotizing enterocolitis via acetate production

Authors - Li-Long Pan
mouseIF

Cell Rep Med

Gut-microbiota-derived 3-indoleacrylic acid alleviates neonatal necrotizing enterocolitis by inhibiting epithelial necroptosis.

Authors - Xiaoliang Dong

Nat Microbiol

Dietary fat alters goblet cell function and microbial bile acid metabolism to promote intestinal lipid absorption in mice.

Authors - Xinyu Liang
mouseWB

Int J Mol Sci

Anti-Proteolytic Peptide R7I Protects the Intestinal Barrier and Alleviates Fatty Acid Malabsorption in Salmonella typhimurium-Infected Mice

Authors - Yunzhe Su
WB

Cell Biochem Funct

Neutrophil Depletion Reduced the Relative Abundance of Unsaturated Long-Chain Fatty Acid Synthesis Microbiota and Intestinal Lipid Absorption

Authors - Xingyu Lu

Commun Biol

Spatially and temporally comparative proteomics provide insights into dynamic response patterns to PEDV infection.

Authors - Wenjiao Jin
Loading...
||
New chat

Able

正在加载,请稍候...