• Featured Product
  • KD/KO Validated

FABP2 Monoclonal antibody, PBS Only

FABP2 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 67691-1-PBS
Clone No.2D11G6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, ELISA

2D11G6, FABPI, Fatty acid binding protein 2, Fatty acid-binding protein 2, Fatty acid-binding protein, intestinal

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67691-1-PBS targets FABP2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17620

Product name: Recombinant human FABP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-132 aa of BC069617

Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Predict reactive species
Full Name fatty acid binding protein 2, intestinal
Calculated Molecular Weight 132 aa, 15 kDa
Observed Molecular Weight15 kDa
GenBank Accession NumberBC069617
Gene Symbol FABP2
Gene ID (NCBI) 2169
RRIDAB_2882884
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP12104
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FABP2, also known as the intestinal fatty acid binding protein (I-FABP), is expressed in the absorptive intestinal villus cells. It is mainly involved in intracellular transport and intestinal absorption of lipids. FABP2 has been considered a marker of mucosal injury and ischemia and serum I-FABP level is used as a tissue damage indicator. In addition, it is a marker of differentiated intestinal epithelial cells.

Loading...
||
New chat Able
正在加载,请稍候...