• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated FABP2 Monoclonal antibody

FABP2 Monoclonal Antibody for IF-P

Cat No. CL488-67691
Clone No.2D11G6

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, rabbit, pig

Applications

IF-P

FABP2, FABPI, Fatty acid binding protein 2, I FABP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse colon tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67691 targets FABP2 in IF-P applications and shows reactivity with Human, mouse, rat, rabbit, pig samples.

Tested Reactivity Human, mouse, rat, rabbit, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17620

Product name: Recombinant human FABP2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-132 aa of BC069617

Sequence: MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Predict reactive species
Full Name fatty acid binding protein 2, intestinal
Calculated Molecular Weight 132 aa, 15 kDa
Observed Molecular Weight15 kDa
GenBank Accession NumberBC069617
Gene Symbol FABP2
Gene ID (NCBI) 2169
RRIDAB_2919522
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP12104
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FABP2, also known as the intestinal fatty acid binding protein (I-FABP), is expressed in the absorptive intestinal villous cells. It is mainly involved in intracellular transport and intestinal absorption of lipids. FABP2 has been considered a marker of mucosal injury and ischemia and serum I-FABP level is used as a tissue damage indicator. In addition, it is a marker of differentiated intestinal epithelial cells.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 FABP2 antibody CL488-67691Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...