Tested Applications
Positive WB detected in | EC109 cells, HEK-293 cells, NCCIT cells, pig brain tissue, rabbit testis tissue, Hela cells, HepG2 cells, Jurkat cells, HSC-T6 cells, 4T1 cells, ATDC-5 cells, MDCK cells, CHO cells, Chicken brain tissue, Zebrafish tissue, human platelet tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, rat testis tisssue, mouse testis tissue |
Positive IHC detected in | human liver cancer tissue, mouse testis tissue, rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse testis tissue |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 7 publications below |
WB | See 630 publications below |
IHC | See 131 publications below |
IF | See 115 publications below |
IP | See 9 publications below |
CoIP | See 4 publications below |
Product Information
67763-1-Ig targets GPX4 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken, zebrafish, hamster, dog samples.
Tested Reactivity | human, mouse, rat, pig, rabbit, chicken, zebrafish, hamster, dog |
Cited Reactivity | human, mouse, rat, pig, rabbit, chicken, bovine, sheep, goat, duck |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag30650 Product name: Recombinant human GPX4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 107-197 aa of BC021567 Sequence: KQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Predict reactive species |
Full Name | glutathione peroxidase 4 (phospholipid hydroperoxidase) |
Observed Molecular Weight | 20-23 kDa |
GenBank Accession Number | BC021567 |
Gene Symbol | GPX4 |
Gene ID (NCBI) | 2879 |
RRID | AB_2909469 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P36969 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPX4 (Phospholipid hydroperoxide glutathione peroxidase, mitochondrial) protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility.It has two isforms about 20KDa and 22KDa, respectively. GPX4 is a monomer,but it has a tendency to form higher mass oligomers (PMID:17630701). It presents primarily in testis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GPX4 antibody 67763-1-Ig | Download protocol |
IHC protocol for GPX4 antibody 67763-1-Ig | Download protocol |
IF protocol for GPX4 antibody 67763-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Host Microbe Liberation of daidzein by gut microbial β-galactosidase suppresses acetaminophen-induced hepatotoxicity in mice | ||
Nucleic Acids Res MEN1 is a regulator of alternative splicing and prevents R-loop-induced genome instability through suppression of RNA polymerase II elongation | ||
Redox Biol LOX-mediated ECM mechanical stress induces Piezo1 activation in hypoxic-ischemic brain damage and identification of novel inhibitor of LOX | ||
Redox Biol A potent phosphodiester Keap1-Nrf2 protein-protein interaction inhibitor as the efficient treatment of Alzheimer's disease | ||
Redox Biol Targeting GPX4-mediated ferroptosis protection sensitizes BRCA1-deficient cancer cells to PARP inhibitors | ||
Drug Des Devel Ther Vancomycin Induced Ferroptosis in Renal Injury Through the Inactivation of Recombinant Glutathione Peroxidase 4 and the Accumulation of Peroxides |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Breanna (Verified Customer) (08-11-2025) | The antibody worked well when testing my GPX4 KO cells! Highly recommend.
|
FH Rajeshkumar (Verified Customer) (07-23-2025) | works very good for human and mic lysates
|
FH Vasu (Verified Customer) (09-23-2024) | We evaluated antibodies from various manufacturers but failed to achieve satisfactory results. However, using the ProteinTech antibody, we successfully detected robust and specific bands corresponding to the expected protein size.
|
FH Tianyi (Verified Customer) (08-17-2023) | Paraffine-embedded ovarian tissue (4% PFA, 24 h) incubated with GPX4 (1:200 dilution) and secondary antibody Alexa fluor donkey anti-mouse 647 IgG (H+L).
![]() |