Tested Applications
| Positive WB detected in | pig stomach tissue, HepG2 cells |
| Positive IHC detected in | human stomach tissue, human small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 31 publications below |
| IF | See 2 publications below |
Product Information
67882-1-Ig targets LPCAT3 in WB, IHC, IF, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6472 Product name: Recombinant human LPCAT3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 122-233 aa of BC065194 Sequence: MAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKR Predict reactive species |
| Full Name | lysophosphatidylcholine acyltransferase 3 |
| Calculated Molecular Weight | 56 kDa |
| Observed Molecular Weight | 56 kDa |
| GenBank Accession Number | BC065194 |
| Gene Symbol | LPCAT3 |
| Gene ID (NCBI) | 10162 |
| RRID | AB_2918639 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q6P1A2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Lysophosphatidylcholine acyltransferases (LPCATs) are among the lysophopholipid acyltransferases (LPLATs) that play an important role in lipid metabolism and homeostasis by regulating the abundance of different phosphatidylcholine (PC) species. Lysophosphatidylcholine acyltransferase 3 (LPCAT3) is a member of the LPCAT family that primarily regulates the levels of arachidonic PC species. LPCAT3 is abundantly expressed in the testes, kidneys, and metabolic tissues, including the liver, intestine, and adipose tissues. LPCAT3 is involved in the occurrence and development of atherosclerosis, intestinal tumors, and nonalcoholic steatohepatitis (NASH)(PMID: 35711841).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LPCAT3 antibody 67882-1-Ig | Download protocol |
| WB protocol for LPCAT3 antibody 67882-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Adv Res Modulation of Macrophage ferroptosis under the guide of infrared thermography promotes the healing of pressure injuries | ||
J Immunother Cancer Mefloquine enhances the efficacy of anti-PD-1 immunotherapy via IFN-γ-STAT1-IRF1-LPCAT3-induced ferroptosis in tumors
| ||
Free Radic Biol Med Role of ferroptosis mediated by abnormal membrane structure in DEHP-induced reproductive injury | ||
Phytomedicine MaiJiTong granule attenuates atherosclerosis by reducing ferroptosis via activating STAT6-mediated inhibition of DMT1 and SOCS1/p53 pathways in LDLR-/- mice | ||
Phytomedicine Rosmarinic acid liposomes suppress ferroptosis in ischemic brain via inhibition of TfR1 in BMECs | ||
J Cell Biol The deubiquitinase ZRANB1 is an E3 ubiquitin ligase for SLC7A11 and regulates ferroptotic resistance |











