LPCAT3 Monoclonal antibody, PBS Only

• 

  WB analysis of pig stomach using 67882-1-Ig (same clone as 67882-1-PBS)

  pig stomach tissue were subjected to SDS PAGE followed by western blot with 67882-1-Ig (LPCAT3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67882-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67882-1-Ig (same clone as 67882-1-PBS)

  WB result of LPCAT3 antibody (67882-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LPCAT3 transfected HepG2 cells. This data was developed using the same antibody clone with 67882-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 67882-1-Ig (same clone as 67882-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 67882-1-Ig (LPCAT3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67882-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 67882-1-Ig (same clone as 67882-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 67882-1-Ig (LPCAT3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67882-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 67882-1-Ig (same clone as 67882-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67882-1-Ig (LPCAT3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67882-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human small intestine using 67882-1-Ig (same clone as 67882-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 67882-1-Ig (LPCAT3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67882-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

LPCAT3 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67882-1-PBS

Clone No.1C1G3

Host / Isotype

Mouse / IgG1

Reactivity

human, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

1-acylglycerophosphocholine O-acyltransferase, 1-acylglycerophosphoethanolamine O-acyltransferase, 1-acylglycerophosphoserine O-acyltransferase, 1C1G3, C3F

---

Product Information

67882-1-PBS targets LPCAT3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, pig samples.

• Tested Reactivity: human, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6472

  Product name: Recombinant human LPCAT3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 122-233 aa of BC065194

  Sequence: MAYLLAGYYYTATGNYDIKWTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMKLVQGELIDIPGKIPNSIIPALKR

• Full Name: lysophosphatidylcholine acyltransferase 3
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC065194
• Gene Symbol: LPCAT3
• Gene ID (NCBI): 10162
• RRID: AB_2918639
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6P1A2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Lysophosphatidylcholine acyltransferases (LPCATs) are among the lysophopholipid acyltransferases (LPLATs) that play an important role in lipid metabolism and homeostasis by regulating the abundance of different phosphatidylcholine (PC) species. Lysophosphatidylcholine acyltransferase 3 (LPCAT3) is a member of the LPCAT family that primarily regulates the levels of arachidonic PC species. LPCAT3 is abundantly expressed in the testes, kidneys, and metabolic tissues, including the liver, intestine, and adipose tissues. LPCAT3 is involved in the occurrence and development of atherosclerosis, intestinal tumors, and nonalcoholic steatohepatitis (NASH)(PMID: 35711841).