• Featured Product
  • KD/KO Validated

eRF3a/GSPT1 Monoclonal antibody

eRF3a/GSPT1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA
Cat No. 68217-1-Ig
Clone No.2A3H6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, FC (Intra), ELISA

eRF3a, GSPT1, 2A3H6, EC:3.6.5.-, ETF3A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, COLO 320 cells, HepG2 cells, pig brain tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
Positive IF/ICC detected inHepG2 cells, PC-3 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 3 publications below

Product Information

68217-1-Ig targets eRF3a/GSPT1 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27986

Product name: Recombinant human GSPT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 294-499 aa of BC009503

Sequence: FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD

Predict reactive species
Full Name G1 to S phase transition 1
Calculated Molecular Weight 68 aa, 4 kDa
Observed Molecular Weight80-85 kDa
GenBank Accession NumberBC009503
Gene Symbol GSPT1
Gene ID (NCBI) 2935
RRIDAB_2935305
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15170
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The eukaryotic Release Factor 3 (eRF3) is a GTPase that associates with eRF1 in a complex that mediates translation termination. Eukaryotic release factor 3 (eRF3) has many functions in eukaryotic cells, such as controlling the regulation of the cell cycle at the G1 to S phase transition, and regulating protein synthesis as a GTP dependent stimulator of eRF1 in translation termination. It was also reported to play a key role as an initiator of the mRNA degradation machinery in the recycling of ribosomes in successive cycles of translation,and probably also in transcription regulation. eRF3a, also known as GSPT1, is one subunit of eRF3(PMID:15917414,12923185). It involves in translation termination in response to the termination codons UAA, UAG and UGA and stimulates the activity of ERF1. eRF3a/GSPT1 exists some isoforms with MV 69 kDa and 56 kDa. Identification of a processed form of eRF3a/GSPT1 as a BIR3-binding protein-Using a GST-BIR3 fusion protein as an affinity reagent to purify new IAP binding proteins from extracts of human cells and mouse tissues, we previously isolated 3 proteins of molecular weights 23, 38 and 80 kDa. 80 kDa band confirmed that it is a processed form of the human GSPT1/eRF3a protein, lacking the first 69 residues(PMID: 12865429).

Protocols

Product Specific Protocols
FC protocol for eRF3a/GSPT1 antibody 68217-1-IgDownload protocol
IF protocol for eRF3a/GSPT1 antibody 68217-1-IgDownload protocol
WB protocol for eRF3a/GSPT1 antibody 68217-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Res

Targeted Degradation of SOS1 Exhibits Potent Anticancer Activity and Overcomes Resistance in KRAS-Mutant Tumors and BCR-ABL-Positive Leukemia

Authors - Ziwei Luo
WB

J Med Chem

Discovery of Potent and Selective G9a Degraders for the Treatment of Pancreatic Cancer

Authors - Yunkai Shi
humanWB

J Med Chem

Discovery of a Proteolysis-Targeting Chimera Degrader of JAK2 as a Potential Therapeutic Agent for JAK2-Mediated Myeloproliferative Neoplasms

Authors - Caolin Wang
Loading...
||
New chat Able
正在加载,请稍候...