• Featured Product
  • KD/KO Validated

eRF3a/GSPT1 Monoclonal antibody, PBS Only

eRF3a/GSPT1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 68217-1-PBS
Clone No.2A3H6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

eRF3a, GSPT1, 2A3H6, EC:3.6.5.-, ETF3A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68217-1-PBS targets eRF3a/GSPT1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27986

Product name: Recombinant human GSPT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 294-499 aa of BC009503

Sequence: FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD

Predict reactive species
Full Name G1 to S phase transition 1
Calculated Molecular Weight 68 aa, 4 kDa
Observed Molecular Weight80-85 kDa
GenBank Accession NumberBC009503
Gene Symbol GSPT1
Gene ID (NCBI) 2935
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15170
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The eukaryotic Release Factor 3 (eRF3) is a GTPase that associates with eRF1 in a complex that mediates translation termination. Eukaryotic release factor 3 (eRF3) has many functions in eukaryotic cells, such as controlling the regulation of the cell cycle at the G1 to S phase transition, and regulating protein synthesis as a GTP dependent stimulator of eRF1 in translation termination. It was also reported to play a key role as an initiator of the mRNA degradation machinery in the recycling of ribosomes in successive cycles of translation,and probably also in transcription regulation. eRF3a, also known as GSPT1, is one subunit of eRF3(PMID:15917414,12923185). It involves in translation termination in response to the termination codons UAA, UAG and UGA and stimulates the activity of ERF1. eRF3a/GSPT1 exists some isoforms with MV 69 kDa and 56 kDa. Identification of a processed form of eRF3a/GSPT1 as a BIR3-binding protein-Using a GST-BIR3 fusion protein as an affinity reagent to purify new IAP binding proteins from extracts of human cells and mouse tissues, we previously isolated 3 proteins of molecular weights 23, 38 and 80 kDa. 80 kDa band confirmed that it is a processed form of the human GSPT1/eRF3a protein, lacking the first 69 residues(PMID: 12865429).

Loading...
||
New chat Able
正在加载,请稍候...