Product Information
68785-2-PBS targets SLC7A11 as part of a matched antibody pair:
MP50151-1: 68785-1-PBS capture and 68785-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30611 Product name: Recombinant human SLC7A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 211-265 aa of BC012087 Sequence: MQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKT Predict reactive species |
| Full Name | solute carrier family 7, (cationic amino acid transporter, y+ system) member 11 |
| Calculated Molecular Weight | 55 kDa |
| GenBank Accession Number | BC012087 |
| Gene Symbol | SLC7A11 |
| Gene ID (NCBI) | 23657 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9UPY5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

