Product Information
68911-3-PBS targets TSLP as part of a matched antibody pair:
MP50325-2: 68911-1-PBS capture and 68911-3-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4771 Product name: Recombinant human TSLP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 79-159 aa of BC016720 Sequence: IQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species |
| Full Name | thymic stromal lymphopoietin |
| Calculated Molecular Weight | 15 kDa, 42 kDa |
| GenBank Accession Number | BC016720 |
| Gene Symbol | TSLP |
| Gene ID (NCBI) | 85480 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q969D9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
