TSLP Monoclonal antibody, PBS Only

Name: TSLP Monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 68911-1-PBS-100UG

TSLP Monoclonal Antibody for Indirect ELISA

Cat No. 68911-1-PBS

Clone No. 1H1G7

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Indirect ELISA

Synonyms

Thymic stromal lymphopoietin

Formulation: PBS Only

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllAffinity

Affinity and Kinetic Characterization of 68911-1-PBS
Biolayer interferometry (BLl) kinetic assays of 68911-1-Ig against Human TSLP were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TSLP in ?

68911-1-PBS targets TSLP in Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag4771 Product name: Recombinant human TSLP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 79-159 aa of BC016720 Sequence: IQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Predict reactive species
Full Name	thymic stromal lymphopoietin
Calculated Molecular Weight	15 kDa, 42 kDa
GenBank Accession Number	BC016720
Gene Symbol	TSLP
Gene ID (NCBI)	85480
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q969D9
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.