Product Information
68964-7-PBS targets ELOVL3 as part of a matched antibody pair:
MP50418-4: 68964-5-PBS capture and 68964-7-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24318 Product name: Recombinant human ELOVL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 18-126 aa of BC034344 Sequence: YNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVI Predict reactive species |
| Full Name | elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 3 |
| Calculated Molecular Weight | 32 kDa |
| GenBank Accession Number | BC034344 |
| Gene Symbol | ELOVL3 |
| Gene ID (NCBI) | 83401 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | Q9HB03 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
