Product Information
68993-2-PBS targets SLC34A1 as part of a matched antibody pair:
MP50486-1: 68993-1-PBS capture and 68993-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag35702 Product name: Recombinant human SLC34A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-103 aa of BC053349 Sequence: MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLK Predict reactive species |
Full Name | solute carrier family 34 (sodium phosphate), member 1 |
GenBank Accession Number | BC053349 |
Gene Symbol | SLC34A1 |
Gene ID (NCBI) | 6569 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q06495 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |