Tested Applications
| Positive WB detected in | A431 cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82094-1-RR targets LY6D in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag10714 Product name: Recombinant human LY6D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC031330 Sequence: MRTALLLLATLAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPT Predict reactive species |
| Full Name | lymphocyte antigen 6 complex, locus D |
| Calculated Molecular Weight | 128 aa, 13 kDa |
| Observed Molecular Weight | 13-14 kDa |
| GenBank Accession Number | BC031330 |
| Gene Symbol | LY6D |
| Gene ID (NCBI) | 8581 |
| RRID | AB_3086462 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q14210 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
LY6D, also named as E48 and ThB, may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. It marks the earliest stage of B-cell specification.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for LY6D antibody 82094-1-RR | Download protocol |
| WB protocol for LY6D antibody 82094-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







