Tested Applications
Positive WB detected in | A431 cells |
Positive FC (Intra) detected in | U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL750-82094 targets LY6D in WB applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag10714 Product name: Recombinant human LY6D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC031330 Sequence: MRTALLLLATLAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPT Predict reactive species |
Full Name | lymphocyte antigen 6 complex, locus D |
Calculated Molecular Weight | 128 aa, 13 kDa |
Observed Molecular Weight | 13-14 kDa |
GenBank Accession Number | BC031330 |
Gene Symbol | LY6D |
Gene ID (NCBI) | 8581 |
RRID | AB_3673737 |
Conjugate | CoraLite® Plus 750 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 755 nm / 780 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q14210 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
LY6D, also named as E48 and ThB, may act as a specification marker at earliest stage specification of lymphocytes between B- and T-cell development. It marks the earliest stage of B-cell specification.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CL Plus 750 LY6D antibody CL750-82094 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |