CD160 Recombinant monoclonal antibody, PBS Only (Capture)

CD160 Uni-rAb® Recombinant Antibody for Cytometric bead array, Indirect ELISA
Cat No. 83184-1-PBS
Clone No.230511B3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

BY55, CD160 antigen, CD160 antigen, soluble form, CD160 molecule, NK1

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83184-1-PBS targets CD160 as part of a matched antibody pair:

MP00237-1: 83184-1-PBS capture and 83184-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Affinity
KD=2.67 x 10-10M
KOff=8.00 x 10-5M
KOn=2.99 x 105M
Immunogen

CatNo: Ag1754

Product name: Recombinant human CD160 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-181 aa of BC014465

Sequence: MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL

Predict reactive species
Full Name CD160 molecule
Calculated Molecular Weight 20 kDa
GenBank Accession NumberBC014465
Gene Symbol CD160
Gene ID (NCBI) 11126
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95971
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD160 is a glycosylphosphatidylinositol (GPI)-anchored protein that is expressed on almost all intestinal intraepithelial lymphocytes (IELs), gamma delta T cells, CD56 (dim) CD16+ cytotoxic NK cells, and a minor subset of CD4+ and CD8+ T cells (PMID: 31332204; 25179432). The binding of CD160 to both classical and non-classical MHC I enhances NK and CD8+ cytotoxic T lymphocyte functions (PMID: 25179432). CD160 is a ligand for HVEM (herpes virus entry mediator) and the binding of CD160 to HVEM inhibits T cell activity (PMID: 19426226).

Loading...
||
New chat

Able

正在加载,请稍候...