Tested Applications
| Positive WB detected in | mouse liver tissue, mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83192-1-RR targets SLC22A4 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag3974 Product name: Recombinant human SLC22A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-142 aa of BC028313 Sequence: NGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWKV Predict reactive species |
| Full Name | solute carrier family 22 (organic cation/ergothioneine transporter), member 4 |
| Calculated Molecular Weight | 551 aa, 62 kDa |
| Observed Molecular Weight | 62-65 kDa |
| GenBank Accession Number | BC028313 |
| Gene Symbol | SLC22A4 |
| Gene ID (NCBI) | 6583 |
| RRID | AB_3670882 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H015 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SLC22A4 (solute carrier family 22 member 4), also known as OCTN1. It is expected to be located in cell membrane and mitochondrion membrane. It is strongly expressed in kidney, trachea, bone marrow and fetal liver and in several human cancer cell lines, but not in adult liver (PMID: 9426230). The protein functions as a Na+-dependent and pH-dependent high affinity microbial symporter of potent food-derived antioxidant ergothioeine (PubMed:15795384), which transports one sodium ion with one ergothioeine molecule.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for SLC22A4 antibody 83192-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



