Product Information
83192-1-PBS targets SLC22A4 as part of a matched antibody pair:
MP00292-3: 83192-4-PBS capture and 83192-1-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag3974 Product name: Recombinant human SLC22A4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-142 aa of BC028313 Sequence: NGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWKV Predict reactive species |
| Full Name | solute carrier family 22 (organic cation/ergothioneine transporter), member 4 |
| Calculated Molecular Weight | 551 aa, 62 kDa |
| Observed Molecular Weight | 62-65 kDa |
| GenBank Accession Number | BC028313 |
| Gene Symbol | SLC22A4 |
| Gene ID (NCBI) | 6583 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9H015 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
SLC22A4 (solute carrier family 22 member 4), also known as OCTN1. It is expected to be located in cell membrane and mitochondrion membrane. It is strongly expressed in kidney, trachea, bone marrow and fetal liver and in several human cancer cell lines, but not in adult liver (PMID: 9426230). The protein functions as a Na+-dependent and pH-dependent high affinity microbial symporter of potent food-derived antioxidant ergothioeine (PubMed:15795384), which transports one sodium ion with one ergothioeine molecule.





