SLC22A4 Recombinant monoclonal antibody, PBS Only (Detector)

SLC22A4 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83192-1-PBS
Clone No.240064D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

240064D5, ETT, ETTh, OCTN1, UT2H

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83192-1-PBS targets SLC22A4 as part of a matched antibody pair:

MP00292-3: 83192-4-PBS capture and 83192-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3974

Product name: Recombinant human SLC22A4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 32-142 aa of BC028313

Sequence: NGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWKV

Predict reactive species
Full Name solute carrier family 22 (organic cation/ergothioneine transporter), member 4
Calculated Molecular Weight 551 aa, 62 kDa
Observed Molecular Weight 62-65 kDa
GenBank Accession NumberBC028313
Gene Symbol SLC22A4
Gene ID (NCBI) 6583
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H015
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SLC22A4 (solute carrier family 22 member 4), also known as OCTN1. It is expected to be located in cell membrane and mitochondrion membrane. It is strongly expressed in kidney, trachea, bone marrow and fetal liver and in several human cancer cell lines, but not in adult liver (PMID: 9426230). The protein functions as a Na+-dependent and pH-dependent high affinity microbial symporter of potent food-derived antioxidant ergothioeine (PubMed:15795384), which transports one sodium ion with one ergothioeine molecule.

Loading...
||
New chat Able
正在加载,请稍候...