Product Information
83226-1-PBS targets SLC2A7 as part of a matched antibody pair:
MP00174-1: 83226-2-PBS capture and 83226-1-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34515 Product name: Recombinant human SLC2A7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 220-281 aa of NM_207420 Sequence: PESPRYSLIQKGDEATARQALRRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLR Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose transporter), member 7 |
| Calculated Molecular Weight | 512 aa, 56 kDa |
| GenBank Accession Number | NM_207420 |
| Gene Symbol | SLC2A7 |
| Gene ID (NCBI) | 155184 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q6PXP3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
