Tested Applications
Positive WB detected in | HeLa cells, HEK-293T cells, MCF-7 cells, Jurkat cells, C6 cells |
Positive IF/ICC detected in | HeLa cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:50000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:150-1:600 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
83266-5-RR targets BUB3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag25608 Product name: Recombinant human BUB3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 205-328 aa of BC005138 Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT Predict reactive species |
Full Name | budding uninhibited by benzimidazoles 3 homolog (yeast) |
Calculated Molecular Weight | 37 kDa |
Observed Molecular Weight | 37-40 kDa |
GenBank Accession Number | BC005138 |
Gene Symbol | BUB3 |
Gene ID (NCBI) | 9184 |
RRID | AB_3670939 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | O43684 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for BUB3 antibody 83266-5-RR | Download protocol |
IF protocol for BUB3 antibody 83266-5-RR | Download protocol |
FC protocol for BUB3 antibody 83266-5-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |