Home
Products
Primary Antibodies
Recombinant Antibodies
BUB3 Recombinant monoclonal antibody, PBS Only (83266-5-PBS)

BUB3 Recombinant monoclonal antibody, PBS Only

Name: BUB3 Recombinant monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 83266-5-PBS-100UG

BUB3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83266-5-PBS

Clone No. 240087D9

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

hBUB3, BUB3L, BUB 3, 240087D9

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICCFC (Intra)Affinity

WB analysis using 83266-5-RR (same clone as 83266-5-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 83266-5-RR (BUB3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 83266-5-RR (same clone as 83266-5-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BUB3 antibody (83266-5-RR, Clone: 240087D9 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 83266-5-RR (same clone as 83266-5-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BUB3 antibody (83266-5-RR, Clone: 240087D9 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 83266-5-RR (same clone as 83266-5-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BUB3 antibody (83266-5-RR, Clone: 240087D9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HeLa using 83266-5-RR (same clone as 83266-5-PBS)
1x10^6 HeLa cells were intracellularly stained with 0.25 ug BUB3 Recombinant antibody (83266-5-RR, Clone:240087D9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HeLa cells were intracellularly stained with 0.25 ug BUB3 Recombinant antibody (83266-5-RR, Clone:240087D9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 83266-5-RR
Biolayer interferometry (BLl) kinetic assays of 83266-5-RR against Human BUB3 were performed. The affinity constant is 0.228 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BUB3 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

83266-5-PBS targets BUB3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity	human, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag25608 Product name: Recombinant human BUB3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 205-328 aa of BC005138 Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT Predict reactive species
Full Name	budding uninhibited by benzimidazoles 3 homolog (yeast)
Calculated Molecular Weight	37 kDa
Observed Molecular Weight	37-40 kDa
GenBank Accession Number	BC005138
Gene Symbol	BUB3
Gene ID (NCBI)	9184
RRID	AB_3670939
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O43684
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.