Product Information
83266-5-PBS targets BUB3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25608 Product name: Recombinant human BUB3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 205-328 aa of BC005138 Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT Predict reactive species |
| Full Name | budding uninhibited by benzimidazoles 3 homolog (yeast) |
| Calculated Molecular Weight | 37 kDa |
| Observed Molecular Weight | 37-40 kDa |
| GenBank Accession Number | BC005138 |
| Gene Symbol | BUB3 |
| Gene ID (NCBI) | 9184 |
| RRID | AB_3670939 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | O43684 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |











