BUB3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83266-5-RR (same clone as 83266-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83266-5-RR (BUB3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83266-5-RR (same clone as 83266-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BUB3 antibody (83266-5-RR, Clone: 240087D9 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83266-5-RR (same clone as 83266-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BUB3 antibody (83266-5-RR, Clone: 240087D9 ) at dilution of 1:300 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 83266-5-RR (same clone as 83266-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using BUB3 antibody (83266-5-RR, Clone: 240087D9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83266-5-RR (same clone as 83266-5-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug BUB3 Recombinant antibody (83266-5-RR, Clone:240087D9) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83266-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83266-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83266-5-RR against Human BUB3 were performed. The affinity constant is 0.228 nM.

BUB3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83266-5-PBS

Clone No.240087D9

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

hBUB3, BUB3L, BUB 3, 240087D9

---

Product Information

83266-5-PBS targets BUB3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25608

  Product name: Recombinant human BUB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 205-328 aa of BC005138

  Sequence: VEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAISFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYEMDDTEHPEDGIFIRQVTDAETKPKSPCT

• Full Name: budding uninhibited by benzimidazoles 3 homolog (yeast)
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 37-40 kDa
• GenBank Accession Number: BC005138
• Gene Symbol: BUB3
• Gene ID (NCBI): 9184
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O43684
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.