MAEA Recombinant monoclonal antibody

MAEA Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83267-1-RR
Clone No.240097B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

EMP, EMLP, EC:2.3.2.27, E3 ubiquitin-protein transferase MAEA, Cell proliferation-inducing gene 5 protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HepG2 cells, C2C12 cells, U2OS cells, A549 cells, HeLa cells, MCF-7 cells
Positive FC (Intra) detected inU-251 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83267-1-RR targets MAEA in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Affinity
KD<1.00 x 10-12M
KOff<1.00 x 10-6M
KOn=9.49 x 104M
Immunogen

CatNo: Ag27150

Product name: Recombinant human MAEA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 26-239 aa of BC001225

Sequence: YETLNKRFRAAQKNIDRETSHVTMVVAELEKTLSGCPAVDSVVSLLDGVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFLTAKEVEESLERRETATCLAWCHDNKSRLRKMKSCLEFSLRIQEFIELIRQNKRLDAVRHARKHFSQAEGSQLDEVRQA

Predict reactive species
Full Name macrophage erythroblast attacher
Calculated Molecular Weight 45 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC001225
Gene Symbol MAEA
Gene ID (NCBI) 10296
RRIDAB_3670940
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7L5Y9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MAEA(macrophage erythroblast attacher) is a core component of the CTLH E3 ubiquitin-protein ligase complex. MAEA is required for normal cell proliferation and plays a role in erythroblast enucleation during erythrocyte maturation and in the development of mature macrophages. N-terminus MAEA and full-length MAEA are mostly expressed in nuclear and can be detected at low level in the cytoplasm of some cells, while C-terminus MAEA can be detected in the cytoplasm and nucleoli within the nucleus. MAEA mediates the attachment of erythroid cell to mature macrophages which can inhibit erythroid cell apoptosis. The expression of MAEA may be associated with the type 2 diabetes mellitus.(PubMed: 28955747, 24143168, 29911972, 29911972, 30674470, 9763581).

Protocols

Product Specific Protocols
WB protocol for MAEA antibody 83267-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...