Tested Applications
| Positive WB detected in | IFN alpha treated HeLa cells, SGC-7901 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83423-1-RR targets IFIT1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag19691 Product name: Recombinant human IFIT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 340-460 aa of BC007091 Sequence: EVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYY Predict reactive species |
| Full Name | interferon-induced protein with tetratricopeptide repeats 1 |
| Calculated Molecular Weight | 478 aa, 55 kDa |
| Observed Molecular Weight | 55-65 kDa |
| GenBank Accession Number | BC007091 |
| Gene Symbol | IFIT1 |
| Gene ID (NCBI) | 3434 |
| RRID | AB_3671072 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P09914 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IFIT1, also known as glucocorticoid-attenuated response gene 16 protein (GARG-16), is a 463 amino acid protein belonging to the IFIT family. IFIT genes comprise a large family with three (IFIT1, IFIT2, and IFIT3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT1 specifically bound virus PPP-RNA forms a complex with IFIT2 and IFIT3 to sequester the viral PPP-RNA and prevent virus replication.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IFIT1 antibody 83423-1-RR | Download protocol |
| WB protocol for IFIT1 antibody 83423-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |











