CNOT4 Recombinant monoclonal antibody, PBS Only (Capture)

CNOT4 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83615-4-PBS
Clone No.240559E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

240559E1, CCR4 associated factor 4, CCR4-associated factor 4, CCR4-NOT transcription complex subunit 4, CLONE243

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83615-4-PBS targets CNOT4 as part of a matched antibody pair:

MP00593-1: 83615-4-PBS capture and 83615-3-PBS detection (validated in Cytometric bead array)

MP00593-2: 83615-4-PBS capture and 83615-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3163

Product name: Recombinant human CNOT4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 273-572 aa of BC035590

Sequence: IDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA

Predict reactive species
Full Name CCR4-NOT transcription complex, subunit 4
Calculated Molecular Weight 575 aa, 64 kDa
Observed Molecular Weight 64-85 kDa
GenBank Accession NumberBC035590
Gene Symbol CNOT4
Gene ID (NCBI) 4850
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95628
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CNOT4, also known as CCR4-NOT transcription complex subunit 4 , has E3 ubiquitin ligase activity, and promotes ubiquitination and degradation of target proteins. CNOT4 is involved in activation of the JAK/STAT pathway. CNOT4 exist many isoforms and the range of its molecular weight from 48 to 84 kDa.

Loading...
||
New chat Able
正在加载,请稍候...