Product Information
83727-3-PBS targets VEGF-C as part of a matched antibody pair:
MP00710-3: 83727-3-PBS capture and 83727-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg32025 Product name: Recombinant Human VEGFC protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 103-227 aa of BC035212 Sequence: TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR Predict reactive species |
Full Name | vascular endothelial growth factor C |
Calculated Molecular Weight | 419 aa, 47 kDa |
GenBank Accession Number | BC035212 |
Gene Symbol | VEGFC |
Gene ID (NCBI) | 7424 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P49767 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |