Product Information
83881-1-PBS targets S1PR2 as part of a matched antibody pair:
MP00831-1: 83881-2-PBS capture and 83881-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag15470 Product name: Recombinant human S1PR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 283-353 aa of BC069598 Sequence: LNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV Predict reactive species |
| Full Name | sphingosine-1-phosphate receptor 2 |
| Calculated Molecular Weight | 353 aa, 39 kDa |
| GenBank Accession Number | BC069598 |
| Gene Symbol | S1PR2 |
| Gene ID (NCBI) | 9294 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O95136 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





