Perforin Recombinant monoclonal antibody, PBS Only (Detector)

Perforin Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 83977-1-PBS
Clone No.241009C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Cytometric bead array, Indirect ELISA

241009C10, Cytolysin, FLH2, HPLH2, Lymphocyte pore-forming protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83977-1-PBS targets Perforin as part of a matched antibody pair:

MP00872-1: 83977-2-PBS capture and 83977-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6060

Product name: Recombinant human Perforin protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 247-555 aa of BC063043

Sequence: EGLTDNEVEDCLTVEAQVNIGIHGSISAEAKACEEKKKKHKMTASFHQTYRERHSEVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSPGLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKLFFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW

Predict reactive species
Full Name perforin 1 (pore forming protein)
Calculated Molecular Weight 61 kDa
Observed Molecular Weight65-70 kDa
GenBank Accession NumberBC063043
Gene Symbol Perforin
Gene ID (NCBI) 5551
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP14222
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Perforin (PRF1) is one of the major cytolytic proteins of cytolytic granules. It is known to be a crucial effector molecule in cytolytic T lymphocyte and natural killer cell-mediated cytotoxicity. This protein has structural and functional similarities to complement component C9. Like C9, this protein creates transmembrane tubules and is capable of lysing nonspecifically a variety of target cells. Defects in PRF1 are the cause of familial hemophagocytic lymphohistiocytosis type 2 (FHL2), which is characterized by immune dysregulation with hypercytokinemia and defective natural killer cell function. (PMID: 2417226; 7774276; 2783486; 10583959)

Loading...
||
New chat Able
正在加载,请稍候...