Product Information
84423-3-PBS targets TWEAKR/CD266 as part of a matched antibody pair:
MP01283-1: 84423-6-PBS capture and 84423-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1838 Product name: Recombinant Mouse TWEAKR/CD266 protein (rFc Tag) (HPLC-verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 28-80 aa of NM_013749.2 Sequence: EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWP Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 12a |
| Calculated Molecular Weight | 14kDa |
| GenBank Accession Number | NM_013749.2 |
| Gene Symbol | Tnfrsf12a |
| Gene ID (NCBI) | 27279 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9CR75 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





