Product Information
84497-1-PBS targets GLAST/EAAT1 as part of a matched antibody pair:
MP01339-1: 84497-2-PBS capture and 84497-1-PBS detection (validated in Cytometric bead array)
MP01339-2: 84497-1-PBS capture and 84497-3-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag16962 Product name: Recombinant human SLC1A3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 471-542 aa of BC037310 Sequence: VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM Predict reactive species |
| Full Name | solute carrier family 1 (glial high affinity glutamate transporter), member 3 |
| Calculated Molecular Weight | 542 aa, 60 kDa |
| GenBank Accession Number | BC037310 |
| Gene Symbol | GLAST |
| Gene ID (NCBI) | 6507 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P43003 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |





