Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, A549 cells, A2780 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84510-4-RR targets TMEM41B in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag30810 Product name: Recombinant human TMEM41B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC035034 Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTF Predict reactive species |
| Full Name | transmembrane protein 41B |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 25-28 kDa |
| GenBank Accession Number | BC035034 |
| Gene Symbol | TMEM41B |
| Gene ID (NCBI) | 440026 |
| RRID | AB_3672019 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q5BJD5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transmembrane protein 41B (TMEM41B), also known as Stasimon, is a major target of survival motor neuron (SMN)-dependent U12 splicing and has been identified as a protein required for motor circuit function (PMID: 23063131). TMEM41B localizes to the endoplasmic reticulum. It is involved in autophagosome biogenesis and lipid mobilization (PMID: 30126924). TMEM41B has been shown to be essential for mouse embryonic development (PMID: 30352685). Additionally, genome-scale CRISPR knockout screens reveal that TMEM41B is required for infection of flavivirus and coronavirus, including SARS-CoV-2 (PMID: 33052348; 33052332). Alternative splicing results in three transcript variants encoding distinct isoforms.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM41B antibody 84510-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
