Product Information
84510-4-PBS targets TMEM41B in WB, Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag30810 Product name: Recombinant human TMEM41B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC035034 Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTF Predict reactive species |
Full Name | transmembrane protein 41B |
Calculated Molecular Weight | 32 kDa |
Observed Molecular Weight | 25-28 kDa |
GenBank Accession Number | BC035034 |
Gene Symbol | TMEM41B |
Gene ID (NCBI) | 440026 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purfication |
UNIPROT ID | Q5BJD5 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
Transmembrane protein 41B (TMEM41B), also known as Stasimon, is a major target of survival motor neuron (SMN)-dependent U12 splicing and has been identified as a protein required for motor circuit function (PMID: 23063131). TMEM41B localizes to the endoplasmic reticulum. It is involved in autophagosome biogenesis and lipid mobilization (PMID: 30126924). TMEM41B has been shown to be essential for mouse embryonic development (PMID: 30352685). Additionally, genome-scale CRISPR knockout screens reveal that TMEM41B is required for infection of flavivirus and coronavirus, including SARS-CoV-2 (PMID: 33052348; 33052332). Alternative splicing results in three transcript variants encoding distinct isoforms.