GPR56 Recombinant monoclonal antibody, PBS Only (Capture)

GPR56 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 84915-1-PBS
Clone No.242249A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

242249A7, ADGRG1, ADGRG1 CT, ADGRG1 C-terminal fragment, ADGRG1 NT

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84915-1-PBS targets GPR56 as part of a matched antibody pair:

MP01673-1: 84915-1-PBS capture and 84915-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2478

Product name: Recombinant Human GPR56 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 26-171 aa of NM_001145771.2

Sequence: RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHN

Predict reactive species
Full Name G protein-coupled receptor 56
Calculated Molecular Weight78 kDa
Observed Molecular Weight65 kDa
GenBank Accession NumberNM_001145771.2
Gene Symbol GPR56
Gene ID (NCBI) 9289
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y653
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GPR56 (G-protein-coupled receptor 56, also named ADGRG1) is a member of the adhesion G-protein coupled receptor (aGPCR) family and one of the important players in the normal development of the brain. It plays a pivotal role in diverse neurobiological processes, including cortical formation, oligodendrocyte development, and myelination (PMID: 32798453). Moreover, GPR56 has been reported to regulate VEGF secretion and angiogenesis in melanoma (PMID: 37579299).

Loading...
||
New chat

Able

正在加载,请稍候...