Tested Applications
| Positive WB detected in | Recombinant protein |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
84960-4-RR targets PTH in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg3191 Product name: Recombinant Human PTH protein (rFc Tag)(HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-115 aa of NM_000315.4 Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ Predict reactive species |
| Full Name | parathyroid hormone |
| Calculated Molecular Weight | 13kDa |
| GenBank Accession Number | NM_000315.4 |
| Gene Symbol | PTH |
| Gene ID (NCBI) | 5741 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01270 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Parathyroid hormone (PTH) is a crucial hormone secreted by the parathyroid glands. The main function of PTH is to regulate calcium and phosphorus metabolism in vertebrates. It increases blood calcium levels and decreases blood phosphorus levels. PTH also plays a role in maintaining bone health and is involved in the regulation of vitamin D metabolism.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PTH antibody 84960-4-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



