PTH Recombinant monoclonal antibody, PBS Only (Capture)

PTH Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 84960-4-PBS
Clone No.242608F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

parathyroid hormone, 242608F8, Parathormone, Parathyrin

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84960-4-PBS targets PTH as part of a matched antibody pair:

MP01717-3: 84960-4-PBS capture and 84960-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3191

Product name: Recombinant Human PTH protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 32-115 aa of NM_000315.4

Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Predict reactive species
Full Name parathyroid hormone
Calculated Molecular Weight13kDa
GenBank Accession NumberNM_000315.4
Gene Symbol PTH
Gene ID (NCBI) 5741
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01270
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Parathyroid hormone (PTH) is a crucial hormone secreted by the parathyroid glands. The main function of PTH is to regulate calcium and phosphorus metabolism in vertebrates. It increases blood calcium levels and decreases blood phosphorus levels. PTH also plays a role in maintaining bone health and is involved in the regulation of vitamin D metabolism.

Loading...
||
New chat Able
正在加载,请稍候...