Product Information
85089-1-PBS targets ASIC1 as part of a matched antibody pair:
MP01789-1: 85089-1-PBS capture and 85089-3-PBS detection (validated in Cytometric bead array)
MP01789-2: 85089-1-PBS capture and 85089-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25941 Product name: Recombinant human ASIC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 464-528 aa of NM_001095 Sequence: MKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC Predict reactive species |
| Full Name | amiloride-sensitive cation channel 2, neuronal |
| Calculated Molecular Weight | 60 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | NM_001095 |
| Gene Symbol | ASIC1 |
| Gene ID (NCBI) | 41 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P78348 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ASIC1(Acid-sensing ion channel 1), also named as ACCN2, BNaC2 or amiloride-sensitive cation channel 2, is a member of the ASICs family. ASICs, an H+-gated subgroup of the epithelial Na+ channel/degenerin (ENaC/DEG) superfamily, are widely expressed throughout the central and peripheral nervous system and triggered by increased extracellular acidification (PMID: 28518134, 27941930). ASIC1 is a key player in acidosis-induced tumor growth and invasiveness. Clinically, alterations of ASIC1 are associated with poor survival in breast cancer (PMID: 26686084).







