Filter:
Tested Applications
| Positive WB detected in | mouse brain tissue, Daudi cells, rat brain tissue, human skeletal muscle tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEL cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85308-2-RR targets MARCH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag20231 Product name: Recombinant human MARCH1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 222-272 aa of BC153124 Sequence: QNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGGPPEVVSV Predict reactive species |
| Full Name | membrane-associated ring finger (C3HC4) 1 |
| Calculated Molecular Weight | 289 aa, 32 kDa |
| Observed Molecular Weight | 31-35 kDa |
| GenBank Accession Number | BC153124 |
| Gene Symbol | MARCHF1 |
| Gene ID (NCBI) | 55016 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8TCQ1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MARCH1 is mainly found in secondary lymphoid organs, more specifically in the endocytic pathway of dendritic cells (DCs) and B cells (11-15). MARCH1 reduces the half-life of peptide/MHC II complexes by causing their redistribution from recycling endosomes to lysosomes. MARCH1 homodimerizes and also forms heterodimers with others family members (PMID: 22508929).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MARCH1 antibody 85308-2-RR | Download protocol |
| IHC protocol for MARCH1 antibody 85308-2-RR | Download protocol |
| WB protocol for MARCH1 antibody 85308-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
