MARCH1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of Daudi using 85308-2-RR (same clone as 85308-2-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 85308-2-RR (MARCH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85308-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 85308-2-RR (same clone as 85308-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85308-2-RR (MARCH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85308-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85308-2-RR (same clone as 85308-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85308-2-RR (MARCH1 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85308-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HEL using 85308-2-RR (same clone as 85308-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEL cells using MARCH1 antibody (85308-2-RR, Clone: 242143G10 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85308-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85308-2-RR

  Biolayer interferometry (BLl) kinetic assays of 85308-2-RR against Human MARCH1 were performed. The affinity constant is 29.7 nM.

MARCH1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85308-2-PBS

Clone No.242143G10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

MARCHF1, E3 ubiquitin-protein ligase MARCHF1, EC:2.3.2.27, MARCH I, MARCH-I

---

Product Information

85308-2-PBS targets MARCH1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20231

  Product name: Recombinant human MARCH1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 222-272 aa of BC153124

  Sequence: QNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGGPPEVVSV

• Full Name: membrane-associated ring finger (C3HC4) 1
• Calculated Molecular Weight: 289 aa, 32 kDa
• Observed Molecular Weight: 31-35 kDa
• GenBank Accession Number: BC153124
• Gene Symbol: MARCHF1
• Gene ID (NCBI): 55016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8TCQ1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MARCH1 is mainly found in secondary lymphoid organs, more specifically in the endocytic pathway of dendritic cells (DCs) and B cells (11-15). MARCH1 reduces the half-life of peptide/MHC II complexes by causing their redistribution from recycling endosomes to lysosomes. MARCH1 homodimerizes and also forms heterodimers with others family members (PMID: 22508929).