Tested Applications
| Positive WB detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85389-1-RR targets Cas9 in WB, ELISA applications and shows reactivity with n/a samples.
| Tested Reactivity | n/a |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25281 Product name: Recombinant Cas9 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-100 aa of NP_269215 Sequence: MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR Predict reactive species |
| Full Name | Cas9 |
| Calculated Molecular Weight | 160 kDa |
| GenBank Accession Number | NP_269215 |
| Gene Symbol | |
| Gene ID (NCBI) | |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes. This antibody detects the sp Cas9.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Cas9 antibody 85389-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



