Cas9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85389-1-RR (same clone as 85389-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85389-1-RR (Cas9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85389-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85389-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85389-1-RR against Human Cas9 were performed. The affinity constant is 3.18 nM.

Cas9 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85389-1-PBS

Clone No.242781G12

Host / Isotype

Rabbit / IgG

Reactivity

n/a

Applications

WB, Indirect ELISA

Synonyms

242781G12

---

Product Information

85389-1-PBS targets Cas9 in WB, Indirect ELISA applications and shows reactivity with n/a samples.

• Tested Reactivity: n/a
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25281

  Product name: Recombinant Cas9 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-100 aa of NP_269215

  Sequence: MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR

• Full Name: Cas9
• Calculated Molecular Weight: 160 kDa
• GenBank Accession Number: NP_269215
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes. This antibody detects the sp Cas9.