MBL Recombinant monoclonal antibody

MBL Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85835-4-RR
Clone No.250108E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, ELISA

Mannan-binding protein, Mannose-binding protein C, Mbl2, MBP-C, RA-reactive factor P28A subunit

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue, mouse serum

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85835-4-RR targets MBL in WB, ELISA applications and shows reactivity with mouse, rat samples.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3157

Product name: Recombinant Mouse Mbl2 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 19-244 aa of NM_010776.1

Sequence: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Predict reactive species
Full Name mannose-binding lectin (protein C) 2
Calculated Molecular Weight26 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberNM_010776.1
Gene Symbol Mbl2
Gene ID (NCBI) 17195
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41317
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for MBL antibody 85835-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...