Use Able AI chat for product recommendations

Mouse MBL Recombinant monoclonal antibody, PBS Only (Capture)

MBL Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85835-4-PBS
Clone No.250108E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Mannan-binding protein, Mannose-binding protein C, Mbl2, MBP-C, RA-reactive factor P28A subunit

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85835-4-PBS targets MBL as part of a matched antibody pair:

MP02145-1: 85835-4-PBS capture and 85835-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3157

Product name: Recombinant Mouse Mbl2 protein (rFc Tag)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 19-244 aa of NM_010776.1

Sequence: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Predict reactive species
Full Name mannose-binding lectin (protein C) 2
Calculated Molecular Weight26 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberNM_010776.1
Gene Symbol Mbl2
Gene ID (NCBI) 17195
RRIDAB_3744411
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP41317
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mannan-binding lectin (MBL) is a calcium-dependent (type C) serum lectin protein that is synthesized in the liver and circulates in the blood. It plays the role of a pattern recognition receptor in the innate immune system. It can recognize the carbohydrate structures on the surface of microorganisms and activate the lectin complement pathway through serine proteases related to mannan-binding lectins (MASPs), thereby achieving phagocytosis and inflammatory responses without the involvement of antibodies.(PMID: 16948640; 16395391)

Loading...
||
New chat

Able

正在加载,请稍候...