Mouse MBL Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 85835-4-RR (same clone as 85835-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85835-4-RR (Mbl2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85835-4-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 85835-4-RR (same clone as 85835-4-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 85835-4-RR (Mbl2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85835-4-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP02145-1

  Cytometric bead array standard curve of MP02145-1, MOUSE MBL Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85835-4-PBS. Detection antibody: 85835-3-PBS. Standard: Eg3157. Range: 0.781-100 ng/mL.

MBL Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85835-4-PBS

Clone No.250108E11

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

Mannan-binding protein, Mannose-binding protein C, Mbl2, MBP-C, RA-reactive factor P28A subunit

---

Product Information

85835-4-PBS targets MBL as part of a matched antibody pair:

MP02145-1: 85835-4-PBS capture and 85835-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3157

  Product name: Recombinant Mouse Mbl2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 19-244 aa of NM_010776.1

  Sequence: ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

• Full Name: mannose-binding lectin (protein C) 2
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: NM_010776.1
• Gene Symbol: Mbl2
• Gene ID (NCBI): 17195
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41317
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.