Tested Applications
| Positive IF/ICC detected in | HeLa cells, U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
85951-2-RR targets HOXA10 in IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag24156 Product name: Recombinant human HOXA10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 203-311 aa of BC013971 Sequence: YGTAKGYGSGGGGAQQLGAGPFPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAEELSPAPSESSKASPEKDSLGNSKGENAA Predict reactive species |
| Full Name | homeobox A10 |
| Calculated Molecular Weight | 393 aa, 41 kDa |
| GenBank Accession Number | BC013971 |
| Gene Symbol | HOXA10 |
| Gene ID (NCBI) | 3206 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P31260 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HOXA10, also named as Homeobox protein Hox-A10, is a 410 amino acid protein, which contains 1 homeobox DNA-binding domain and belongs to the Abd-B homeobox family. HOXA10 localizes in the nucleus and can Interacts with SIRT2. HOXA10 as sequence-specific transcription factor, is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. HoxA10 expression increases during the midsecretory phase of the menstrual cycle, which corresponds with increased levels of circulating progesterone.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HOXA10 antibody 85951-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
